Donegal Daily
  • News
  • Sport
  • Courts
  • Jobs
  • Business
  • Lifestyle
  • Travel
  • Politics
  • Features
  • Donegal County Council News
Sunday 15°CMonday 16°C

Donegal Daily Donegal Daily

sponsor banner
sponsor banner
  • News
  • Sport
  • Courts
  • Jobs
  • Business
  • Lifestyle
  • Travel
  • Politics
  • Features
  • Donegal County Council News
HealthNews

Private Covid test centre responding to continued high levels in Donegal

written by Staff Writer January 28, 2021
FacebookTweetLinkedInPrint

Sponsored Post – Updated

A private Covid-19 testing centre in Co. Donegal is responding to an increased demand for a variety of tests as the scope of testing and travel changes in Ireland.

Medical personnel with Med checks, now JaceMedical.ie have operated a drive-through testing centre in Letterkenny for the past month.

In that time, demand has spiked for PCR testing and Antigen tests for a variety of needs.

Overall however, staff have noted that Covid-19 continues to be prevalent in the community.

Company founder Dr John Doherty is a Consultant Anaesthetist at Altnagelvin Hospital.

“I’m still very concerned about the high levels of Covid in Donegal. There are concerns over new strains and sadly it is going to be here for some time, despite everybody’s continued good efforts.”

The pop-up MedChecks clinic offers rapid COVID-19 RT-PCR, rapid antigen and rapid antibody testing with results being obtained on the same-day (antigen and antibody tests) or within 24 hours from testing (PCR test).

Pop-up Medchecks Test Centre at the Clanree Hotel car park, Port Road Letterkenny

Meanwhile, private PCR testing at MedChecks is meeting some specific needs: 

“The PCR tests are catering for people who are preparing for scheduled surgeries. People might be asked to go to Sligo, Galway or Dublin for a test before their procedures, but they can come to us.”

“PCR tests also help with contact tracing. Additionally they provide ‘fit to fly’ and ‘test to release’ certification in compliance with government requirements.”

MedChecks testing is led by senior qualified medical personnel and nursing staff.

Dr Doherty said demand for antigen tests has picked up in three strands – the general population who are concerned that they might have Covid, and international travellers visiting countries such as the Netherlands which have made antigen rapid tests necessary before departure. With recently announced requirements HGV drivers are required to have rapid antigen test prior to departure from the Irish ports to UK and Europe. Medchecks hopes to meet this demand also.

Additionally Medchecks has been responding locally in Donegal to requests for rapid antigen testing in the corporate environment. They have developed a mobile responsive team who visit the workplace to do on-site testing. 

MedChecks mobile response team

In recent weeks, the company has expanded into other border areas in Monaghan and Dundalk.

Dr Doherty stressed that, given the high levels of Covid in Donegal, people should continue to closely follow all government guidance in relation to COVID 19.

“I do feel we at MedChecks have made an impact by helping identify COVID 19 and providing the public immediate decision making to keep themselves, their relatives and the community at large safe during these challenging times.”

“I would like to stress that we at MedChecks work closely with the Public Health reporting systems and contact tracing so understanding of the epidemiology of COVID 19 in Donegal is developed. An important aspect for us is that we are reducing the burden on the public service.”

Medchecks in Letterkenny is open seven days per week. Details on pricing, booking and opening hours are available at JaceMedical.ie

Private Covid test centre responding to continued high levels in Donegal was last modified: November 4th, 2021 by Staff Writer
FacebookTweetLinkedInPrint

Tags:
coronaviruscovid-19Dr John Dohertyfit to flyletterkennymedcheckspcrprivate covid testingrapid antigentest to releaseworkplace testing
Staff Writer

LEAVE A COMMENT

You may also like

Drug driver arrested & more cars seized...

11 hours ago

National: Man (60s) killed after being struck...

13 hours ago

“Expect delays” – Advice issued for Donegal...

14 hours ago

Castlefin woman admits her part in collision...

15 hours ago

Van driver nabbed for drink driving &...

17 hours ago

Gardaí arrest THIRD cocaine driver in first...

19 hours ago

Driver nabbed doing 174kph in 100kph zone...

1 day ago

Road closed following traffic collision in Ramelton

1 day ago

Extension of rent pressure zone legislation “welcome...

1 day ago

Gardai block access to Downings beach to...

1 day ago
Advertisement
Advertisement

Donegal County Council

Facebook
Donegal County Council
Advertisement
Advertisement
Donegal Daily Jobs

Read More

  • News
  • Sport
  • Courts
  • Jobs
  • Sales & Services
  • Obituaries
  • Features
  • Business
  • Politics
  • Council News

Information

  • Contact Us
  • About
  • Advertise WIth Us
  • Privacy Policy
  • Disclaimer
  • Terms & Conditions

Our Sites

Donegal Woman
Donegal Woman
Donegal Daily

© 2025 Donegal Daily. All rights reserved.
Website by owenod


Back To Top.

We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy